PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG010751t1
Common NameTCM_010751
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family Trihelix
Protein Properties Length: 382aa    MW: 43710.1 Da    PI: 6.5215
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG010751t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix86.53.3e-2772153286
          trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                       W ++e++ Li +rrem+  ++++k++k+lWe++s+kmre+gf rsp++C++kw+nl k++kk k+++++     s +++y++++e
  Thecc1EG010751t1  72 WVQDETRSLIGFRREMDGLFNTSKSNKHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEFKKAKHQDRGS---GSAKMSYYKEIE 153
                       ********************************************************************84...556899***997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-462133IPR009057Homeodomain-like
PROSITE profilePS500908.29364128IPR017877Myb-like domain
SMARTSM007170.007768130IPR001005SANT/Myb domain
CDDcd122032.96E-2970135No hitNo description
PfamPF138375.7E-2171155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MYLSEKPRPI DLYKEEGPTT ARDMIIEVTT NVDLPPHHHP PPLQQQQQQM ILGDSSGEDP  60
EVKAPKKRAE TWVQDETRSL IGFRREMDGL FNTSKSNKHL WEQISAKMRE KGFDRSPTMC  120
TDKWRNLLKE FKKAKHQDRG SGSAKMSYYK EIEEILRERT KNAYKSPTPP PKVDSFMHFA  180
DKGFEDTGIS FGPVEASGRP TLNLERRLDH DGHPLAITAT DAVAASGVPP WNWRETPGNG  240
GDCQSYGGRV ITVKFGDYTR RIGIDGTADA IREAIKSAFR LRTKRAFWLE DEDHIVRSLD  300
REMPLGIYTL HVDEGLAIKV CLYDESDHIP VHTEEKIFYT EDDYREYLAR RGYTGLRDID  360
GYRNVDNMDD LRTNVIYRGV S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A3e-5266151186DNA binding protein GT-1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00004PBMTransfer from 920224Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU8964136e-48KU896413.1 Hibiscus cannabinus microsatellite HC_ES_37_CTC sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007044983.10.0Homeodomain-like superfamily protein
SwissprotQ9FX530.0TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLA0A061E7350.0A0A061E735_THECC; Homeodomain-like superfamily protein
STRINGGLYMA11G37390.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28912768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.10.0Trihelix family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]